PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN41176.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 246aa    MW: 28117.5 Da    PI: 6.1741
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN41176.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.91.7e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+ eEde+l  +vk++G  +W+  ++  g+ R++k+c++rw++yl
       KHN41176.1 14 KGAWSREEDEKLTAYVKRHGHSNWRQLPKFAGLARCGKSCRLRWLNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.61.1e-1668111247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      g+ T eE+++++++++++G++ W++Ia++++ gRt++++k++w+ +
       KHN41176.1  68 GNYTLEEEKIIIKLHQEFGNK-WSLIAEKLP-GRTDNEVKNYWHGH 111
                      789******************.*********.***********966 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.499961IPR017930Myb domain
SuperFamilySSF466891.52E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-121363IPR001005SANT/Myb domain
PfamPF002491.1E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-231568IPR009057Homeodomain-like
CDDcd001672.68E-101661No hitNo description
PROSITE profilePS5129424.23262116IPR017930Myb domain
SMARTSM007173.6E-1666114IPR001005SANT/Myb domain
PfamPF002492.4E-1568111IPR001005SANT/Myb domain
CDDcd001678.32E-1269112No hitNo description
Gene3DG3DSA:1.10.10.607.9E-2569114IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MVRAPFYDKN GLKKGAWSRE EDEKLTAYVK RHGHSNWRQL PKFAGLARCG KSCRLRWLNY  60
LRPNLKHGNY TLEEEKIIIK LHQEFGNKWS LIAEKLPGRT DNEVKNYWHG HLKKIKSNEI  120
TTSKLKSKPG YSIEVNSNET HQCEKSESPY ADVGDDFPYI LESSLAMSRE STSEGDNYSL  180
TSIVSLSTMD SSLSKEESVP PLVSYEEFSS DFWTEPFLTE DTFTNEICSG EGIALLIPNF  240
DGAYLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25121145106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150397e-59AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007132613.11e-114hypothetical protein PHAVU_011G109800g
TrEMBLA0A0B2S3670.0A0A0B2S367_GLYSO; Myb-related protein Myb4
STRINGGLYMA06G45531.11e-97(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.14e-57myb domain protein 15
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]